SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000030040 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000030040
Domain Number 1 Region: 359-406,435-494
Classification Level Classification E-value
Superfamily Supernatant protein factor (SPF), C-terminal domain 6.41e-28
Family Supernatant protein factor (SPF), C-terminal domain 0.0019
Further Details:      
 
Domain Number 2 Region: 59-145
Classification Level Classification E-value
Superfamily Acyl-CoA binding protein 1.96e-18
Family Acyl-CoA binding protein 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000030040   Gene: ENSDARG00000024602   Transcript: ENSDART00000032827
Sequence length 495
Comment pep:novel chromosome:Zv9:17:33581227:33592348:1 gene:ENSDARG00000024602 transcript:ENSDART00000032827 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMEFDGEDQGSDRLEKTSSENGINTETHALDTQEDHKTCQDNETPQKSWSLDRNWGFTLE
ELFRLALKFFKEMNGKAFNPTYEENLRLVALHKQITLGPYNPNSCPDIGFFDVLGNDRRK
EWLSLGSMAKEDAMEDFVKLLNSCCSLFAPYVTSHKIEKEDQERRQKEEEERLRLEREEQ
ERRRLEEEERRREEEERRAIEEEQRRKEEAQRLQIERQKQQIMAVLNAQTAVQFQQYAKQ
QYPDNPEQQQLLIRQLQEQHFQQYVQQALRLQQMASQKQQEESTVIQTSEALPAPISNEA
VSICNPNSQSNSLDNHKQQKDQKNSHLVVEGETGVVPIVAPSMWTRPQIKEFKEKVLHDE
DSVITVGRGEVLTIRVPTHPDGSYLFWEFATDHYDIGFGLHFEWKDLTAPTSSNNGGEST
TETKEGTAQAEEEKTEQGRIPLVNEVAPVSRRDSHEEVYAGSHQYPGEGVHLLKFDNSYS
LWRPKVVYYRVYYTR
Download sequence
Identical sequences F1QA40
ENSDARP00000030040 ENSDARP00000030040

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]