SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000033758 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000033758
Domain Number 1 Region: 5-107
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.94e-28
Family Pointed domain 0.0000509
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000033758   Gene: ENSDARG00000024431   Transcript: ENSDART00000032184
Sequence length 219
Comment pep:known_by_projection chromosome:Zv9:18:46855246:46863037:-1 gene:ENSDARG00000024431 transcript:ENSDART00000032184 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DLECADVPLLTRGSHSSASQQALSLFCFFINKNERVIVSADPREWTEGHVREWLTWTVNE
FSLKNVDFHKFSMDGASLCALGKERFLDLAPDFVGDILWGHLEMLQKEDPKHFPVSSLSS
SFQESRYPSEYFFNYGIEHPQCVPPSEYSEPSFITESYQTLHPISSEDLLSLKYESEYPN
VILRDAPLNPLQGDYFSVKQEVVSPDNMCVGRISRGEFG
Download sequence
Identical sequences ENSDARP00000033758

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]