SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000034818 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000034818
Domain Number 1 Region: 139-368
Classification Level Classification E-value
Superfamily SET domain 3.79e-79
Family Histone lysine methyltransferases 0.0000284
Further Details:      
 
Domain Number 2 Region: 30-92
Classification Level Classification E-value
Superfamily Chromo domain-like 1.26e-20
Family Chromo domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000034818   Gene: ENSDARG00000026799   Transcript: ENSDART00000038955
Sequence length 411
Comment pep:known chromosome:Zv9:8:24248412:24258048:1 gene:ENSDARG00000026799 transcript:ENSDART00000038955 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARDLKDCRVPCKLLLEDLQALCRRKKLVCKQLSVTKNNFNDYEVEYLCNYKKHKGREFF
LVKWKGYEESENTWEPLKNLKCPILLHQFRKDMKAALLQANEPLDSASLSGPIISFLRQK
ATQRIRLKKWEDLMNQTCWHKGRIFVSNEVDMDGPPKNFTYINENKLGKGVDMNAVIVGC
ECEDCVSQPVDGCCPGLLKFRRAYNESRRVKVMPGVPIYECNSKCRCGPDCANRVVQRGI
QYDLCIFKTDNGRGWGVRTLQRINKNSFVMEYLGEIITTDEAEQRGVLYDKQGVTYLFDL
DYVDDVYTIDAAHYGNISHFVNHSCDPNLQVYNVFIDNLDERLPRIALFAKRGIKAGEEL
TFDYKMTVDPVDAESTKMDLDFSRAGIEGSPIKRVHMECKCGVRNCRKYLF
Download sequence
Identical sequences Q6DGD3
ENSDARP00000034818 7955.ENSDARP00000034818 ENSDARP00000034818

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]