SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000037031 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000037031
Domain Number 1 Region: 28-116
Classification Level Classification E-value
Superfamily Supernatant protein factor (SPF), C-terminal domain 2.22e-21
Family Supernatant protein factor (SPF), C-terminal domain 0.012
Further Details:      
 
Weak hits

Sequence:  ENSDARP00000037031
Domain Number - Region: 124-184
Classification Level Classification E-value
Superfamily MTH1598-like 0.0732
Family MTH1598-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000037031   Gene: ENSDARG00000026908   Transcript: ENSDART00000037183
Sequence length 201
Comment pep:known chromosome:Zv9:10:3427334:3435132:-1 gene:ENSDARG00000026908 transcript:ENSDART00000037183 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFTFSELIVLLCALSYTASGYFVSIDAHAEECFYERVNSGTKMSLMFEVAEGGFLDIDVK
ITGPDGKQIYKGDRESSGKYSVAAHMDGTYKFCFSNEMSTMTPKIVMFTIDIGEAPKGQD
METEAHQNKLEEMINELAVAMTAVKHEQEYMEVRERIHRAINDNTNSRVVLWSFFEALVL
VAMTLGQIYYLKRFFEVRRVV
Download sequence
Identical sequences Q7ZW75
NP_955842.1.45394 7955.ENSDARP00000037031 ENSDARP00000037031

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]