SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000039666 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000039666
Domain Number 1 Region: 127-191
Classification Level Classification E-value
Superfamily Chromo domain-like 5.5e-27
Family Chromo domain 0.0000187
Further Details:      
 
Domain Number 2 Region: 40-102
Classification Level Classification E-value
Superfamily Chromo domain-like 1.59e-22
Family Chromo domain 0.0000501
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000039666   Gene: ENSDARG00000054442   Transcript: ENSDART00000039667
Sequence length 203
Comment pep:known chromosome:Zv9:12:30418624:30429817:-1 gene:ENSDARG00000054442 transcript:ENSDART00000039667 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQTSEPSADAAVTEAPVSQSEPKQITAGKKQNKKKVEEVVEEEEEEYVVEKVLDRRVVK
GKVEYLLKWKGFSDEDNTWEPDENLDCPDLIAEFLQSQKTAESGGKRRAETDGDGKETKK
RKDEPEKLRGFARGLDPERIIGATDSSGELMFLMKWKNSDEADLVPAKEANVKCPQVVIS
FYEERLTWHSYPTEEEEKKDDKN
Download sequence
Identical sequences Q6IQ71
NP_001002090.1.45394 XP_005156294.1.45394 7955.ENSDARP00000039666 ENSDARP00000039666 ENSDARP00000113004 ENSDARP00000039666

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]