SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000043594 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000043594
Domain Number 1 Region: 77-150
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 8.64e-19
Family HLH, helix-loop-helix DNA-binding domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000043594   Gene: ENSDARG00000030402   Transcript: ENSDART00000043595
Sequence length 171
Comment pep:known chromosome:Zv9:19:2456982:2459008:-1 gene:ENSDARG00000030402 transcript:ENSDART00000043595 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFEEEAMHEDSSSPESPVDSLGNSEEELDRRQPKRVSRKKRASRKNAEDSDSPTPGKRSK
KCSNSSSSPQSLEDLQTQRVMANVRERQRTQSLNEAFASLRKIIPTLPSDKLSKIQTLKL
AARYIDFLCQVLQSDELDSKMSSCSYVAHERLSYAFSVWRMEGAWSMSTSH
Download sequence
Identical sequences Q9PTE3
ENSDARP00000043594 7955.ENSDARP00000043594 ENSDARP00000043594 NP_571059.1.45394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]