SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000044079 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000044079
Domain Number 1 Region: 23-81
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000000000107
Family HLH, helix-loop-helix DNA-binding domain 0.0063
Further Details:      
 
Weak hits

Sequence:  ENSDARP00000044079
Domain Number - Region: 86-111
Classification Level Classification E-value
Superfamily Orange domain-like 0.0235
Family Hairy Orange domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000044079   Gene: ENSDARG00000032963   Transcript: ENSDART00000044080
Sequence length 155
Comment pep:known chromosome:Zv9:23:21739064:21741127:-1 gene:ENSDARG00000032963 transcript:ENSDART00000044080 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPHSATLASFDHLHFSDKEKIKLRKPIVEKMRRDRINTCIDQLKSLLEKEFHSHDPSTK
LEKADILEMTVSFLKQQIKQQQQIPQRDFNEGYSHCWRESVHFLSLHSNAGELQHLHSGP
KTNSTMGSTPATACSKLNTAALQHPDSVRAVWRPW
Download sequence
Identical sequences Q6TA36
7955.ENSDARP00000099379 ENSDARP00000044079 NP_991182.1.45394 ENSDARP00000044079 ENSDARP00000099379

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]