SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000045384 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000045384
Domain Number 1 Region: 64-140
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000000000249
Family HLH, helix-loop-helix DNA-binding domain 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000045384   Gene: ENSDARG00000030347   Transcript: ENSDART00000045385
Sequence length 236
Comment pep:known chromosome:Zv9:7:16082277:16085567:1 gene:ENSDARG00000030347 transcript:ENSDART00000045385 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQTSSKNQWSSSSSESEFSSISSPETTSPDQSFSPPHQTKPPCSKLVKSSNIMKKKRRLR
LKNPSEQRQNASEKEKLRMRDLTKALHHLRSFLPASVAPVGQTLTKIETLRLTIQYISFL
SSQLGLSEEELSYRRQENSSGCSLSSFECSSVSGGFVGTEQGYALCDGQYEDCSGYGGQY
RERYGGLTQQHSTEQNGLVSIDGFIQSQQCGQMTQTPYQVYGKNFGYHLVPQTYWR
Download sequence
Identical sequences F1Q9Z5
7955.ENSDARP00000045384 ENSDARP00000045384 ENSDARP00000045384

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]