SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000045970 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000045970
Domain Number 1 Region: 605-736
Classification Level Classification E-value
Superfamily Bromodomain 4.84e-32
Family Bromodomain 0.001
Further Details:      
 
Domain Number 2 Region: 475-602
Classification Level Classification E-value
Superfamily Bromodomain 7.2e-31
Family Bromodomain 0.00047
Further Details:      
 
Domain Number 3 Region: 28-160
Classification Level Classification E-value
Superfamily Bromodomain 4.58e-29
Family Bromodomain 0.0013
Further Details:      
 
Domain Number 4 Region: 180-288
Classification Level Classification E-value
Superfamily Bromodomain 5.23e-28
Family Bromodomain 0.00094
Further Details:      
 
Domain Number 5 Region: 359-462
Classification Level Classification E-value
Superfamily Bromodomain 3.4e-26
Family Bromodomain 0.00097
Further Details:      
 
Domain Number 6 Region: 1326-1405
Classification Level Classification E-value
Superfamily HMG-box 2.36e-17
Family HMG-box 0.00082
Further Details:      
 
Domain Number 7 Region: 785-851
Classification Level Classification E-value
Superfamily Bromodomain 0.00000000183
Family Bromodomain 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000045970   Gene: ENSDARG00000003877   Transcript: ENSDART00000045971
Sequence length 1559
Comment pep:known_by_projection chromosome:Zv9:11:3971866:4016800:-1 gene:ENSDARG00000003877 transcript:ENSDART00000045971 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMGSKRRRATSPSSSVSGGDFEDSQSTSISSTSRKRRRIANIPTVDPIAVCHELYNTIRD
YKDDQGRMLCELFIRAPKRRNQPDYYDVVSQPIDMMKIQQKLKMEEYDDVEQLTSDFQLL
FSNAKTYYKPETPEYRAACKLWDLYIRTKNEFVQRGDYDEDDDDDDPQENLGGATEEESM
SSLKEVLGMLLDAVLTYTEHGRLISELFQRLPSKMQYPDYYAIIKEPIDLKSIAHRIQMC
YYKSVNHMAKDIDLLVKNAKTYNEPGSQVFKDANTIKKVFAQKKLELEHSEPIKCSIRIR
NRRFAHGDRLSCITTALQYGSESEEDAILTGSVHYDEVESEAESIHSSMDVSNPIFQMYE
AVRGVRNSQGQLLAEPFFQLPSRKDYPDYFQQISHPVSLQQIRSKMKNNEYESVEQIDTD
LNRMFENAKRYNVPSSQIYKRVLKLQHILQMKRKELTRRDDEDGDSRLSSTLSDGGSTKR
KSHKKNTKKNRMKALLAAVAETREMGTGRRLCDLFMVKPSKKDYPDYYKIILEPMDMRII
EHNIRSDKYPNEDSMMEDMKLMFRNARHYNEEGSRVYNDANILEKILREKRKELGPPPDD
DEIVSPKLKIRKSGISPKKSKYLTPLQQKLNELYEAVKNYTDKRGRRLSTIFLRLPSRAE
LPDYYVAIKKPIDMEKIKSHMLANKYQDVDALVEDLVLMFNNACTYNEPESLIYKDALVL
HKVLLETRRDLEGGDDAHVPDVARLIQELVRNLFVSVLGHQDDEGRCYSDSLAEIPAVDP
NCSDKTPLNFEIIRANVDKGRYRRLDVFQDQMFEVLEKARRLHRTDSEIFEDSVELQQFF
IRIRDELCKNGEILLTPALSYTIKHLHSDVEKEKKEKLPKEYEEDKLKREEEKKEAEKSE
DTAGGGWQGALQRNYSQDCSFKDNMYHVGDYVYVEPTEPNLQPHIVCIERLWQDDAGENW
LYGCWFYRPNETFHLATRKFLEKEVFKSDYYNKIPVSKILGKCVVMFVKEYFKLQPDSFR
PEDVFVCESRYSAKTKSFKKIKMWTMPLSSVKFVPREVPLPVVRVASMFAPKQESEKPPE
VTEDDKALPSVIDKEKEDITLEVNNGEPGCQYYEQLCYNNIWLKVGDCVYIRSHGLVRNR
VGRIEKMWVRDGAAYFFGPIFIHPEETEHEPTKMFYKKEVFLSNLEESCPMTCIGGKCTV
SSFKDFLSCRPTEMPEEDVLLCESRYIESEKQMKKFKGLKRFSLSAKVVEDEIYYFRKLI
VPQKEPSPLLEKKIEELEAKFADMTDEELDDLGDDDGDGSDAHCMPQLQTQLSGDMDMLH
YAPQQSVPKSIKGLSKKEGAKRKINMSGYILFSSEMRAVIKAQHPDFSFGELSRLVGTEW
RNLEATKKAEYEERAAKVAEQQERDRAHQGSPRAGMNGMAPGSTGSAYGTQMGGMNSGQQ
VPPPYPGQGQVGQPAHQQPSTPMFVAPPPKPQRLLHSEAYLKYIEGLSAESTTVSKWDQT
LSARRKDVRLTKEQESRLPSHWLKSKGAHKTMADALWRLRDLMLRDTLNIQHTYNIHNI
Download sequence
Identical sequences XP_009304061.1.45394 ENSDARP00000045970 ENSDARP00000045970

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]