SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000046688 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000046688
Domain Number 1 Region: 28-107
Classification Level Classification E-value
Superfamily Supernatant protein factor (SPF), C-terminal domain 0.00000000000000209
Family Supernatant protein factor (SPF), C-terminal domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000046688   Gene: ENSDARG00000028816   Transcript: ENSDART00000046689
Sequence length 206
Comment pep:known chromosome:Zv9:7:31512174:31514199:-1 gene:ENSDARG00000028816 transcript:ENSDART00000046689 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRHSFLLLAVYIAFVNATELTFELPDNEKQCFYEELEQGVKFDIDFQVIAGGNYDVDCFV
TDPINNMLYQERKKQYDSFSHTTVMKGVYKVCFSNEFSTFSHKTVYLDFRSGEDDRLFPD
QNRATALTQMESACLSIHEILKVVSDSQTWYRLREAQDRLRAEDLHERVHFWSIGETVIL
FVVCIGQVLMLKSFFNEKKTGVSTST
Download sequence
Identical sequences B3DKM3
ENSDARP00000046688 ENSDARP00000046688 NP_001122140.1.45394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]