SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000047722 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000047722
Domain Number 1 Region: 138-194
Classification Level Classification E-value
Superfamily RING/U-box 0.00000298
Family RING finger domain, C3HC4 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000047722   Gene: ENSDARG00000042508   Transcript: ENSDART00000047723
Sequence length 288
Comment pep:known chromosome:Zv9:9:3944017:3963918:-1 gene:ENSDARG00000042508 transcript:ENSDART00000047723 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RRQRARERQQKLLAEFASRQKSFMETAMDVESPEADAVMDVSSEESLDSEVLYDCVICGQ
SGPSTEDRPTGLVVLLQASSVLGHRCRSDMPKRLPTTDEEHIYPEDTCGATHDVRLSLMQ
RYFKDSSCLQSVSIGWDGGVYVQTCGHTLHIDCHKSYMESLRNDQVLQGISVDKGEFTCP
LCRQFANSVLPCRPGRGMETGAWHAPSTKSMSTLVKEVEDLQEQLGIFPVRASIKQRDPI
LVFIRVLPIPSFLFFPSHPSILIQSKSWCHTDLHVFMPHLTLLWFNFS
Download sequence
Identical sequences ENSDARP00000047722

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]