SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000047840 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000047840
Domain Number 1 Region: 516-580,843-962
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 7.59e-45
Family Ypt/Rab-GAP domain of gyp1p 0.0065
Further Details:      
 
Domain Number 2 Region: 2-179
Classification Level Classification E-value
Superfamily RUN domain-like 1.96e-28
Family RUN domain 0.001
Further Details:      
 
Domain Number 3 Region: 939-1059
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 8.63e-26
Family Ypt/Rab-GAP domain of gyp1p 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000047840   Gene: ENSDARG00000028857   Transcript: ENSDART00000047841
Sequence length 1069
Comment pep:known_by_projection chromosome:Zv9:5:21818597:21876524:1 gene:ENSDARG00000028857 transcript:ENSDART00000047841 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QVKQIMEEAVTRKFVHEDSSHIVSFCAAVEACVLHGLKRRAAGFLRSNKIAALFTKVAKN
FPPAEELCRKAQELELVFENRRSQSLSYSESTRKMPKVLNFSPQAVRHVWIHAALIEKVL
DKIVLYLVENSSKFYEKEAILMDPVDGPILASLLVGPCALEYTKMKTADHFWTDPSADEL
VQRHRIHSGHCRQDSPTKRPALCIQKRHSSSSMDERPSPSPSARDYVESLHQNSRATLLF
GKNNVLVQPRDDMEAVPGYLSLHQTADYMTLKWTPNQLMNGSVGDLDYEKSVYWDYAMTI
RLEEIVYLHCHQQEVDCGGTVVLVSQDGIQRPPLRFPRGGHLLQFLSCLENGLLPHGQLD
PPLWSQRGKGKVFPKLKKRCPQGSSESVSDKEEEEATDYVFRIVFPNSQSEFVVAPELID
QGANMWHPTPRKSSCSSCSQNSFSDGAQPNGCNHERTPLKLLCDNMKNQIISRAFYGWLA
YCRHLSTVRTHLSGLVNHTIVEPDVPSDAYSGLTTEVWQKFLQDCSTYEEKELLRLVYFG
GVEPSLRKEVWPFLLGHYQFGMSETERKEVDEQMRACYEQTMSEWLGCEAIVKQKEKEQH
AVALAKCSSGASMDSTTQRIMHRDSTISNESSQSCSSDRQRDSRLQSDSSSGTQVFESVE
EVEQIESEPKNDVGKQVCKISNGTPQNGTSSPDSGHPSSRNFSVTSGQSDSLSTEDSGIH
EPNLKSQPQLTASKEKAACCGEEGKETEEPDHSQVTKMEVGESLERSLTSENDALTRHTE
PDIPKATEVMESTPPEQEAHGKLSSEEVNPEKPEMESLCPQLDSLAVNTEKIEASSPVSS
IGTTYSQELLDMYTLNLHRIDKDVQRCDRNYWYFTPANLEKLRNIMCSYVWQHLEIGYVQ
GMCDLLAPLLVILDDEAMAFSCFTELMKRMNQNFPHGGAMDTHFANMRSLIQILDAELFE
LMHQNGDYTHFYFCYRWFLLDFKRELVYDDVFAVWETIWAAKCVSSSHFVLFIALSLVEI
YRDIILENNMDFTDIIKFFNEMAEHHNIKQILTLSRDLVCKVQTLIENK
Download sequence
Identical sequences ENSDARP00000047840 ENSDARP00000047840

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]