SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000048758 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000048758
Domain Number 1 Region: 36-87
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000144
Family HLH, helix-loop-helix DNA-binding domain 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000048758   Gene: ENSDARG00000029544   Transcript: ENSDART00000048759
Sequence length 130
Comment pep:known chromosome:Zv9:20:29810838:29813118:-1 gene:ENSDARG00000029544 transcript:ENSDART00000048759 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKAVSPVRSVRKPALCFSEHNMGISRSNDPLSLLYNMNDCYSRLKELVPSLPQNRSVSKM
EILQHVIDYILDLQIALDQNPLQQQQQQSLGQSPPKKTVRSLGADISIISFQPSNPQREI
NTDDLIALSR
Download sequence
Identical sequences Q6PBJ0
ENSDARP00000048758 ENSDARP00000108958 NP_955835.1.45394 XP_005160687.1.45394 7955.ENSDARP00000048758 ENSDARP00000048758

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]