SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000053417 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000053417
Domain Number 1 Region: 530-814
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 7.2e-40
Family C5 cytosine-specific DNA methylase, DCM 0.0035
Further Details:      
 
Domain Number 2 Region: 196-330
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 1.14e-35
Family PWWP domain 0.00000254
Further Details:      
 
Domain Number 3 Region: 433-505
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000112
Family PHD domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000053417   Gene: ENSDARG00000036791   Transcript: ENSDART00000053418
Sequence length 816
Comment pep:known chromosome:Zv9:23:17182172:17272078:-1 gene:ENSDARG00000036791 transcript:ENSDART00000053418 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRKEEIKKSTEIVMPSNKYPSAESDKMTATAAMNRDTSVGDGLSENDSGLEMTSENSPLT
PAEPPSPFCPKQNGGAASPADESVNSIRRKRSRKRSDTEEDSAWDSSYSEEKAEVGSGCE
TGLRQRPRPRTIFQAGLTAHSKPRSRERGHSKEDHSDLVASVPEGPALELMEQDSKDSAQ
SSTTSTSTTETASQPEYKDNKGFGIGELVWGKIKGFSWWPGMVVTWRATGRRQASHGMRW
LQWFGDGKFSEVSADKLDSITAFPKFFNQSSYTKLASYRRAIFQALEVASLRAEKTFPPS
EADSLEEQVKPMLDWAHGGFLPKGQEGLKPKENAEYCVFPLASESSTLLESSPPEFPPSA
KRARLPLNKAKPGIEEVYSREQMVNEVLKNHRSIEEFCLSCGKTRVATFHPLFEGGLCLT
CKDAYLENSYMYDDDGYQSYCTVCCGGREMLLCGNANCCRCICVDCLDILVGAGAANSAR
NLDPWRCYMCQPLQQYGVLKKRHDWSLKLQEFFVNDSGQEFESPKIYPAVPAEQRRPIRV
LSLFDGIATGYLVLRDLGFKVDLYIASEVCEDSISVGAVRHEGKIQYVHDVRNITRKNIA
EWGPFDMVIGGSPCNDLSIVNPARKGLYEGTGRLFFEFYRLLSEAKPKEGEDRPFFWMFE
NVVAMSVNDKRDISRFLECNPVMIDAIEVSAAHRARYFWGNLPGMKRPLCASGMDKLELQ
DCLEHGRVAKFGKVRTITTRSNSIKQGKDQHFPVMMNGKEDILWCTELERIFGFPVHYTD
VSNMGRGARQKLLGRSWSVPVIRHLFAPLKDYFACE
Download sequence
Identical sequences Q588C6
ENSDARP00000053417 ENSDARP00000053417 NP_001020621.1.45394 7955.ENSDARP00000053417

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]