SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000054688 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000054688
Domain Number 1 Region: 174-233
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 1.18e-16
Family HLH, helix-loop-helix DNA-binding domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000054688   Gene: ENSDARG00000037555   Transcript: ENSDART00000054689
Sequence length 266
Comment pep:known chromosome:Zv9:14:9679437:9694510:-1 gene:ENSDARG00000037555 transcript:ENSDART00000054689 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKNPHLNSPCKILNTVSGDKKMKRKAREPIKHVSEDHYPYFKLYKNPHLMAETLGDGSPQ
ETHRSEIITSRDDSVRNDVLNTAVDMRINTITAAEVPDSKLRSVSEKTVNSKIVQASPQV
SVLSAPQVFPLERVVLSQRAASQAPAGGSERAESPRKRAGEPSGVVTEIKAIQQTRRLLA
NARERTRVHTISAAFEALRKQVPCYSYGQKLSKLAILRIACNYILSLAQLADLDYTPDHR
NMSFRECVEQCTRTLQAEGRSKKRKE
Download sequence
Identical sequences D2CLZ9
ENSDARP00000054688 NP_001073460.2.45394 ENSDARP00000054688

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]