SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000055705 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000055705
Domain Number 1 Region: 19-73
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000209
Family HLH, helix-loop-helix DNA-binding domain 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000055705   Gene: ENSDARG00000054560   Transcript: ENSDART00000055706
Sequence length 149
Comment pep:known chromosome:Zv9:11:43102143:43103588:-1 gene:ENSDARG00000054560 transcript:ENSDART00000055706 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPVYMTEYSKLSNKEKHKLRKPVVEKMRRDRINNCIEQLKSMLEKEFQQQDPNAKLEKA
DILEMTVVFLKQQLRPKTPQNAQIEGYSQCWRETISFLSVGSEAVAQRLQQEARRSAAPE
LTHTSEAPHQQHTHIKQEPRAHAPLWRPW
Download sequence
Identical sequences A8E5M4
7955.ENSDARP00000055705 ENSDARP00000055705 ENSDARP00000055705

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]