SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000055708 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000055708
Domain Number 1 Region: 17-70
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000406
Family HLH, helix-loop-helix DNA-binding domain 0.0059
Further Details:      
 
Weak hits

Sequence:  ENSDARP00000055708
Domain Number - Region: 79-110
Classification Level Classification E-value
Superfamily Orange domain-like 0.000497
Family Hairy Orange domain 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000055708   Gene: ENSDARG00000038205   Transcript: ENSDART00000055709
Sequence length 133
Comment pep:known chromosome:Zv9:11:43073538:43077202:-1 gene:ENSDARG00000038205 transcript:ENSDART00000055709 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPTVCKATHTGKERTKLRKPVVEKMRRDRINKCIEQLKILLKTEIKASQPCSKLEKADI
LEMAVIYLKNTADAHARSYSEAHAQSYADGYSRCIEETARFLSAHKQTQKHSKPVDSCQI
TSEIAKHGLWRPW
Download sequence
Identical sequences F6PBN7
ENSDARP00000055708 XP_005155978.1.45394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]