SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000055755 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000055755
Domain Number 1 Region: 173-369
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 2.56e-47
Family Ypt/Rab-GAP domain of gyp1p 0.0044
Further Details:      
 
Domain Number 2 Region: 345-454
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 5.23e-26
Family Ypt/Rab-GAP domain of gyp1p 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000055755   Gene: ENSDARG00000038237   Transcript: ENSDART00000055756
Sequence length 500
Comment pep:putative chromosome:Zv9:17:23065949:23083702:-1 gene:ENSDARG00000038237 transcript:ENSDART00000055756 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GVRRQSAPDRVDVDPNASSDQTLGTKRHGIADFLTRSLFSWKPKESRAVASHSAPGWKLF
GKIQLRDNPLKDSRTIQQEYESRAGPATGPPLHPPPTRRKNLEFEPLSTTALILEDRPAN
LPAKSEEESQRHRQEYSEMVAGAKRREMKEAQKKKRQMKERYRQEENIASAMVIWNSEVL
PNWESMRNTRRVRDLWWQGVPPSVRGKVWCLAIGNELNITPELYEIFLSRAKEKWRSFSE
TSSVNENEDCGVSLADRESSLDLIKLDISRTFPSLYIFQKGGPYHDILHSVLGAYTCYRP
DVGYVQGMSFIAAVLILNLEEADAFIAFANLLNKPCQMAFFRVDHDLMLKYFAAFEVFFE
ENLPRLFQHFQNNSLTPDFYLIDWIFTLYSKSLPLDVACRVWDVFCRDGEEALFRTGLGI
LRLYQDVLLQMDFIHSAQFLSRLPENTPAHTLFSCIANTQMISNNRRWNQVFSTLIKDRL
KETDKISNSSSNSNSPALRS
Download sequence
Identical sequences E7F9N1
ENSDARP00000055755

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]