SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000057865 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000057865
Domain Number 1 Region: 69-134
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 5.89e-18
Family HLH, helix-loop-helix DNA-binding domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000057865   Gene: ENSDARG00000039602   Transcript: ENSDART00000057866
Sequence length 204
Comment pep:novel chromosome:Zv9:12:12874158:12874933:-1 gene:ENSDARG00000039602 transcript:ENSDART00000057866 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPHPDTPFGQFIWRETDRSHSEQCPKAPMGWREEQLQDRASCDPCALVQLRLTGLSYSSE
EQSSIARARRRRRLAANARERRRMLGLNVAFDRLRSVIPNVESDRKLSKSETLQMAQIYI
STLSELLEDKDCDPETPYPTLTMQDQDITKGLPMTEETKTELKNNPTCRIRSYNGNFGCL
TCSDHKTAELLVDSHCLERNNGVK
Download sequence
Identical sequences F1Q7A7
ENSDARP00000057865 XP_003199618.1.45394 XP_021336148.1.45394 ENSDARP00000057865

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]