SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000060945 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000060945
Domain Number 1 Region: 5-195
Classification Level Classification E-value
Superfamily RUN domain-like 4.71e-35
Family RUN domain 0.00063
Further Details:      
 
Domain Number 2 Region: 1307-1427
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 5.23e-33
Family Ypt/Rab-GAP domain of gyp1p 0.0067
Further Details:      
 
Domain Number 3 Region: 1403-1525
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 1.28e-27
Family Ypt/Rab-GAP domain of gyp1p 0.0081
Further Details:      
 
Domain Number 4 Region: 527-594
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 0.0000000228
Family Ypt/Rab-GAP domain of gyp1p 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000060945   Gene: ENSDARG00000075376   Transcript: ENSDART00000060946
Sequence length 1533
Comment pep:known_by_projection chromosome:Zv9:10:1665488:1706385:1 gene:ENSDARG00000075376 transcript:ENSDART00000060946 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGESETRQRLLRNVKKEVKQIMEEAVTRKFVHEDSSHIISFCGVVEACVLHGLKRRAAGF
LRSNKLAALFMKVGKMFPPAEDLCRKVQELEQIIENKQNQSQMSQESVRKQPRPPNLSPL
AIKHLWIRTALTQKLLDKIVLYLVENSSKFYEREALLRDPVDGPILASLLVGPCALEYTK
AKTANHFWTDPSADELVQRHRIHSGHCRQDSPTKRPALIQKRQSSGSMDDRPSLWARDYV
ESLHQNSRATLLFGKNNVLVQPTDDMEAIPGYLSLHQTADLMTLKWTPNQLMNGNTEFDY
EKSVYWDFAMTIRLEEIVYLHCHQQVDSGGTVVLVSQDGIQRPPFRFPKGGHLLQFLTCL
ETGLLPHGQLDPPLWSQRGKGKVFPKLRKRSPHGSCESFSDKDEDEATDYVFRIIYPGSQ
EFVAPELIEQAVNMWQPTPRKSSCSSCSQNGSSDGGLPNGCNHDRAPLKLLCETMKHQII
SRAFYGWLAYCRHLSTVRTHLSALVNATIVEPDIPYDAKGGLSADVWKSFLQDCSAYEEE
ELLRLVYYGGVEPSLRKEVWPFLLGHYHFTMSPEERKEVDEQIRACYEQTMSEWLGCEAI
VRQREKEQHAAALAKCVSGASVDRGSRQDSTISTDSSQSSNSDKQSHAGSHSDSNSSTQV
FGSVDEVDPIESEPKPKDEKPQPKIPNGALPNCTSSPDSGHPSSRNFSVTSAMSDCSPSA
EETSTQESKGNQPDIEEKPKEEQPENSSTTQDTDKAAITTQNESKLQTSETSRAETDQIK
DAISKNPTNLSEPKEDEVNPGAEADARKSEVNKCEVQPLKDPAEESRSSESKQAEDADPV
SLSIVDEDTKSNTEQEIGLKVNEDSKSQQSAPESTPEDVNISQNLSSESKTGQETGLKVN
EDPKCQQSTPESTSDCMKTSQSLSSESNMEQKANEDSKSQQSAPESKSDDVKTSQNLSSG
SNTKQETSLKVSEDSNCQPSAPESTSEAMKTSQNLSSESNTEQETGLKVNEDSKCQPSAP
ESTSEAMKTSQNLSSESNTEQETGLKVNEDSKCQPSAPESTPEHMKTSQNLSSESNTEQE
TGLKVNKDSKSEQSAPKSTPEHMKTCLNLSSELNMEQATGLKVNKDSKCQPSAPESTLDD
MKTSQNLSSGPQNVPQTAPQTISWDSEHNRARSIIKQMTESESESCGPLTSLSKPSPDMS
DDSPSALEMEEIPSSVVYMSSESSMCRTPLTLARPVAPCIAAGEKSPMGMPALELCMEPG
VNTTPEGTDSALSEEEPEMDNLFPKPDSLAVTGDKNDIASPVSSIGTTYSQELVDLYTLN
LHRIDKDVQRCDRNYWYFTPANLEKLRNIMCSYVWQHLDIGYVQGMCDLLAPLLVILDDE
AMAFSCFTELMKRMNQNFPHGGAMDTHFANMRSLIQILDSELFELMQQNGDYTHFYFCYR
WFLLDFKREMVYDDVFSVWETIWAARYASSEHFVLFIALALVELYRDIILENNMDFTDII
KFFNEMAERHDVPKLLVMARDLVHKVQILIENK
Download sequence
Identical sequences E7F2K9
ENSDARP00000060945 XP_003199319.1.45394 ENSDARP00000060945

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]