SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000062524 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000062524
Domain Number 1 Region: 384-438,470-522
Classification Level Classification E-value
Superfamily Supernatant protein factor (SPF), C-terminal domain 1.1e-30
Family Supernatant protein factor (SPF), C-terminal domain 0.0018
Further Details:      
 
Domain Number 2 Region: 78-165
Classification Level Classification E-value
Superfamily Acyl-CoA binding protein 3.53e-16
Family Acyl-CoA binding protein 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000062524   Gene: ENSDARG00000042623   Transcript: ENSDART00000062525
Sequence length 523
Comment pep:known chromosome:Zv9:20:30728439:30747770:1 gene:ENSDARG00000042623 transcript:ENSDART00000062525 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATEVQSGDLNSANSSRLEVSIDGLTLSPDSEGEQEQAETPDGQSAEQSHENPEQSVDGE
EGEPTSSANIERKWGFALVELYGLALRFFKEKDGKAFHPTYKDKLRLVALHKQVLQGPYN
PDASPEVGFFDVLGNDRRKEWASLGNMEKEESMLEFVRLLNKCCNLFAPFVASHKIEKEE
QERKRREEEEQRRREEEEYERLRQEEERRRREEEERLRREEEERRQIEEERLRIEQQKQQ
IMAALNAQTAIQFQQYAAQQYPDSPEQQLILIRQLQEQHYQQYMQQLYQVQLAQQQAALQ
KQQEDAIVLSTLEASEVSAPCGEEVPTLNGQAESTTDSIERDQDLEPADEVTENGPTDSP
PVIAAPSMWTRPQIKDFKVKIRQDVDSVITVGRGEVVTVRVPTHEEGSYLFWEFATDYYD
IGFGVFFEWTDSTNASVSVHVSESSDEEEEEEGEAQSEEEKAKKESGKPQVDEIVPVYRR
DCHEEVYAGSHQYPGRGIYLLKFDNSYSLWRSKTVYYRVYYTR
Download sequence
Identical sequences Q5RHP5
ENSDARP00000062524 ENSDARP00000062524 NP_001315136.1.45394 7955.ENSDARP00000062524

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]