SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000065168 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000065168
Domain Number 1 Region: 142-329
Classification Level Classification E-value
Superfamily TRAF domain-like 8.5e-61
Family SIAH, seven in absentia homolog 0.0000000116
Further Details:      
 
Domain Number 2 Region: 81-142
Classification Level Classification E-value
Superfamily RING/U-box 0.00000383
Family RING finger domain, C3HC4 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000065168   Gene: ENSDARG00000044381   Transcript: ENSDART00000065169
Sequence length 330
Comment pep:known chromosome:Zv9:21:37619561:37678113:-1 gene:ENSDARG00000044381 transcript:ENSDART00000065169 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRPSSAGGAAGGLGAGKAGGSKHGGSGGTTASAAAAAAAAAAAAAAAAAAGVSGSVAGS
GTVPAAAVALPVAALPGQSPELTALFECPVCFDYVLPPILQCQAGHLVCNQCRQKLSCCP
TCRGPLTPSIRNLAMEKVASTLPFPCKYSSAGCLLSLHHSEKPEHEEVCEFRPYTCPCPG
ASCKWQGSLEEVMPHLMHAHKSITTLQGEDIVFLATDINLPGAVDWVMMQSCFGHHFMLV
LEKQEKYEGHQQFFAIVLLIGTRKQAENFAYRLELNGNRRRLTWEATPRSIHDGVAAAIM
NSDCLVFDTSIAHLFADNGNLGINVTISMC
Download sequence
Identical sequences G8JL17
7955.ENSDARP00000065168 ENSDARP00000065168 ENSDARP00000065168 NP_956721.2.45394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]