SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000065566 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000065566
Domain Number 1 Region: 14-170
Classification Level Classification E-value
Superfamily EF-hand 3.76e-38
Family Calmodulin-like 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000065566   Gene: ENSDARG00000044629   Transcript: ENSDART00000065567
Sequence length 185
Comment pep:known chromosome:Zv9:21:22021461:22025502:-1 gene:ENSDARG00000044629 transcript:ENSDART00000065567 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNNHASLDDILAEDMHHWYNKFMRESPSGLITLFELKSILGLQGMNEDANSYVDQVFCT
FDMDRDGYIDFVEYIAAISLMLKGEINQKLKWYFKLFDQDGNGKIDKDELETIFTAIQDI
TRNRDIVPEEIVALIFEKIDVNGEGELTLEEFIEGAKEHPEIMDMLKILMDLTPVLLIIV
EGRQK
Download sequence
Identical sequences Q6ZM98
NP_001011661.1.45394 7955.ENSDARP00000065566 ENSDARP00000065566 ENSDARP00000065566

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]