SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000066052 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000066052
Domain Number 1 Region: 9-71
Classification Level Classification E-value
Superfamily Chromo domain-like 9.47e-20
Family Chromo domain 0.00079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000066052   Gene: ENSDARG00000044938   Transcript: ENSDART00000066053
Sequence length 514
Comment pep:known chromosome:Zv9:3:10535521:10548188:1 gene:ENSDARG00000044938 transcript:ENSDART00000066053 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRTAMEELSAVGEQVFDAECILNKRTRKGKLEYLVKWRGWSSKHNSWEPQENLLDPRLLV
AFNKREQEKELLISKKGKRPRGRPRKIMETIPVVSKSSSSSSSSSSSGSSSSSSSSSSST
DDDDEDDHNMTPKPIPRPREHLPVPQKKAQIVVAKPGPPKKRGRKALPPELKAIRQVKGT
RKILKPISRDSDLRGIKKPLMPASFTYTGLNRTSGREPMAMHNRGSFTHKSSLSSLGRSI
GSVSSSPTLNRSPQTKSASDFKLSVSDMNSGLDPKTPTCKSPGVAALNLHSSNGQTCPQL
SPTVPKDQTLLQRSASLPKSPSSSFSSLKTPSSLQALNLQSVNKTVQGNGTDLKTSPHSG
RKSSGFNTSSAPNTPSKFQTSQQALKSPQKLKADDLAERLGKKSQARTEKILPTEGRDSQ
PAQDRPSSKDPSKQSKTLSELSTGEEGSSSDTDHDSSFPRDSHDLSISVQAGQDWRPTRS
LIEHVFVTDVTANLVTVTVKESPTSVGFFSIRNY
Download sequence
Identical sequences F1Q982
ENSDARP00000066052

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]