SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000066697 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000066697
Domain Number 1 Region: 59-139
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 6.8e-18
Family HLH, helix-loop-helix DNA-binding domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000066697   Gene: ENSDARG00000045353   Transcript: ENSDART00000066698
Sequence length 160
Comment pep:known_by_projection chromosome:Zv9:24:13639965:13643052:1 gene:ENSDARG00000045353 transcript:ENSDART00000066698 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTGSVSDPEDLQSISHCLDDSEDDFSLDDGLKPKPKSKTPRGAASNTNKPQMKLAKDGR
QSQRNAANARERARMRVLSKAFSRLKTSLPWVPADTKLSKLDTLRLASSYISHLRQLLQD
DTYHNNLAHPANLTWPFVVSARSEDTKDISAAVRLCGATA
Download sequence
Identical sequences E7FEX0
ENSDARP00000066697 7955.ENSDARP00000066697 ENSDARP00000066697 XP_684279.3.45394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]