SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000066924 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000066924
Domain Number 1 Region: 237-435
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 4.32e-52
Family Ypt/Rab-GAP domain of gyp1p 0.00000324
Further Details:      
 
Weak hits

Sequence:  ENSDARP00000066924
Domain Number - Region: 84-137
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 0.0687
Family Skp1 dimerisation domain-like 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000066924   Gene: ENSDARG00000045510   Transcript: ENSDART00000066925
Sequence length 491
Comment pep:known chromosome:Zv9:4:27009856:27193922:-1 gene:ENSDARG00000045510 transcript:ENSDART00000066925 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSDGNKKQFWKRNTAKVPGNIQHVYGAQHPPFDPLLHANLMKAGNKPPSASTPGKPKKA
TTFQEFESITSDAWDVGDDDDELLAMAAQNLNIEVVMETANKVIENHSKLQERRQQQMEK
TTEPDEKYGEEVEEEEEEPEEEEEREEVVETTDVSFSSDALPFGDSRLVKSHSEAPIGSP
KEVGIEQAALHRQQSLPHRPVIPLVARMADQNTSGTPAMTEREASRLDKFRQVLAGPNTD
LEELRKLSWSGIPRQVRPITWKLLSGYLPANAERRESTLQRKRQEYFGFIEQYYDSRNDE
HHQDTYRQIHIDIPRTNPLIPLFQQASVQEIFERILFIWAIRHPASGYVQGINDLVTPFF
VVYVFEYIEEEVENFNVSSLQEEVLRNIEADSFWCMSKLLDGIQDNYTFAQPGIQRKVKA
LEELVSRIDETVHRHMQLYEVEYLQFAFRWMNNLLMRELPLRCTIRLWDTYQVRRHSTVF
VYAFLLTYSHT
Download sequence
Identical sequences F1REN9
ENSDARP00000066924

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]