SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000067665 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000067665
Domain Number 1 Region: 37-124
Classification Level Classification E-value
Superfamily Supernatant protein factor (SPF), C-terminal domain 3.01e-22
Family Supernatant protein factor (SPF), C-terminal domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000067665   Gene: ENSDARG00000046022   Transcript: ENSDART00000067666
Sequence length 216
Comment pep:known chromosome:Zv9:8:442391:447707:1 gene:ENSDARG00000046022 transcript:ENSDART00000067666 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGSSSSWLLPLFVQVVMMKVGLSSASELTFELPDNAKQCFYEDITIGTKCTLEFQVVTG
GHYDVDCRLEDPEGTVLYKEMKKQYDSFTFSAARNGTYKFCFSNEFSTFTHKTVYFDFQV
GDDPPLFPNENRVTALTQMESACVSIHEALKSVMDYQTHFRLREAQGRSRAEDLNSRVAF
WSVGEALILLVVSVSQVLLLRSFFSDRKTTTTRMGS
Download sequence
Identical sequences F1RAM9
ENSDARP00000067665 ENSDARP00000067665 NP_001300637.1.45394 NP_001300638.1.45394 NP_001300639.1.45394 NP_998077.2.45394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]