SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000068724 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000068724
Domain Number 1 Region: 120-168,204-263
Classification Level Classification E-value
Superfamily Supernatant protein factor (SPF), C-terminal domain 2.35e-30
Family Supernatant protein factor (SPF), C-terminal domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000068724   Gene: ENSDARG00000052390   Transcript: ENSDART00000074235
Sequence length 264
Comment pep:known chromosome:Zv9:17:45304834:45317368:-1 gene:ENSDARG00000052390 transcript:ENSDART00000074235 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEKLETSELQSRLSSLSVSSFPGITSKNCEANPLNRLQSTDLSQTVIPPDNQTKMDDNSN
NQELSQSTEEPGSTLGKAEAGESQESSSSHPAEKKALPPMKPASTWTSVALKDLKTKLRQ
EKDSVVTVYRGDIMTVHVPTVPEAKRVCWEFATDGYDIGFGVYFDWSPVTSRAITVHISE
SSDDEDEDDELEGPVVPGDVEKGSKSSANTNLGEILPVYRQDSHLAVQGGSHDFPGEGTY
LLKFDNSYSLWRNKTLYYRVYYSA
Download sequence
Identical sequences Q502M2
7955.ENSDARP00000068724 ENSDARP00000068724 ENSDARP00000068724 ENSDARP00000128367 NP_001018152.1.45394 XP_017207126.1.45394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]