SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000068987 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000068987
Domain Number 1 Region: 63-136
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 6.02e-16
Family HLH, helix-loop-helix DNA-binding domain 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000068987   Gene: ENSDARG00000052610   Transcript: ENSDART00000074499
Sequence length 244
Comment pep:known chromosome:Zv9:13:46534586:46535663:1 gene:ENSDARG00000052610 transcript:ENSDART00000074499 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSDASSTCSRSSSPDLTVDSGFFSNKMFQAYGETVQQKSEKGLQNAGKTRTRADLSKDD
LQDLRLKVNSRERKRMHDLNQAMDGLREVMPYAQGPSVRKLSKISTLLLARNYILMLSSS
LEEMKKLVGDVYGANAQSHSARRVLPPTSAAPATQLPLLSLAPSLHPLVGSTSAVSHTTT
NGAQTPHSPPSTGYLGFPALPTLLKDPLHLSGGYRHFPGMPCPCSLCQPLPASTASLHSL
SMGK
Download sequence
Identical sequences Q5K548
NP_955808.1.45394 ENSDARP00000068987 7955.ENSDARP00000068987 ENSDARP00000068987

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]