SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000071525 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000071525
Domain Number 1 Region: 395-515
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 2.25e-31
Family Ypt/Rab-GAP domain of gyp1p 0.0036
Further Details:      
 
Domain Number 2 Region: 281-417
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 2.2e-26
Family Ypt/Rab-GAP domain of gyp1p 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000071525   Gene: ENSDARG00000005927   Transcript: ENSDART00000077057
Sequence length 582
Comment pep:known chromosome:Zv9:3:30318067:30337390:-1 gene:ENSDARG00000005927 transcript:ENSDART00000077057 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAKPESHKLIFEKEGVYLHTNAKRSNQDTTIPGFIRIVERDGEPALEWSPVEDDGRNAP
AVFYTKKDGEGGEEETKFDPGYEPDWAVISTVKQDRRQEQPPVRETGHWSSFSLPLSELY
SLRRARFSLGRNFLVLTTRGGDPLPPLHFHRGGTRELLKAMQRYIRLAPSPMDGRLFLAY
PHDSGALSQSFDELHLFDDTSADLVSRFIQDPYATTFGGFSKVTNFFRGALRNPESPLNN
RSPQDPHFPHSADEEPGFELITCGAELGPRPEVKRGKPLDNWEQFLDPEGRVTDPQKVKE
LVFRGGIVPYLRKEVWKFLLGFYPWNSTTKEREDILMVKTDEYFRMKVQWKSVSEEQEMS
DLLSPLLFVTQNEVESFWCLTGFMDLVHQNFEESQEAMKQQLLQLSLLLRALDPELCDYL
DSQDSGSLCFCFRWLLIWFKREFSFEDILSLWEVLWTRLPCENFHLLMACSILESQKEEL
IGSNHDFNSILKHINELTMKLDLQSVLCGAEAIYLQLTHCKELSPKVQEVLGLRIPSGSS
EQSPDSEACEMDTLLSHSQARGATSCQPFNGHTPQRPPPTYP
Download sequence
Identical sequences F1QM41
ENSDARP00000071525

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]