SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000071555 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000071555
Domain Number 1 Region: 41-84
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000000222
Family HLH, helix-loop-helix DNA-binding domain 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000071555   Gene: ENSDARG00000054823   Transcript: ENSDART00000077087
Sequence length 116
Comment pep:known chromosome:Zv9:17:27113089:27114986:-1 gene:ENSDARG00000054823 transcript:ENSDART00000077087 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKAISPVRSVRSCYEAVCCISEQSLAISRCKSPSEELSDMNMNDCYSKLKELVPSIPQNK
SVSQVEILQHVIDYIFDLQIALENETDTQNTPDIFLSMKNSEMSRNFSKEDGAMCH
Download sequence
Identical sequences Q8QFX4
7955.ENSDARP00000071555 ENSDARP00000071555 ENSDARP00000071555 NP_694499.1.45394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]