SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000072614 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000072614
Domain Number 1 Region: 143-378
Classification Level Classification E-value
Superfamily SET domain 5.36e-83
Family Histone lysine methyltransferases 0.0000141
Further Details:      
 
Domain Number 2 Region: 45-102
Classification Level Classification E-value
Superfamily Chromo domain-like 0.000000000000403
Family Chromo domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000072614   Gene: ENSDARG00000055753   Transcript: ENSDART00000078152
Sequence length 421
Comment pep:known chromosome:Zv9:8:26603906:26614487:-1 gene:ENSDARG00000055753 transcript:ENSDART00000078152 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAENLKAQVCRVACIATTEQLEVVCRDEGVVCEELGISRNNLCDYEVEYLCDYKRKVITD
GKRQTVQELYLVKWKGYPESRNTWEPRRNLRCVNLLSQFWEDLNAEMQRQNKRSAPRRLD
PATVTHLTQRAKLRQTLKQWETHLNSLGTHKGYISVRNQVDLEGPPKSFTYINDYKVGDG
ILLNEVSVGCECTDCLASPVEGCCAGASQHKFAYNELGQVRIRPGLPIYECNKRCRCGPD
CSNRVVQRGIRYSLCIFRTDNGRGWGVRTMERIRKNTFVMEYVGEIITTEEAERRGHVYD
KEGATYLFDLDYVDDEYTVDAAHYGNISHFVNHSCDPNLQVYNVFIDNLDERLPRIAFFA
TRGIKAGEELTFDYNMKIDPVDAESTKMDTNFGVMGLPGSPKKRMRVECKCGVATCRKYL
F
Download sequence
Identical sequences B0S6M0
7955.ENSDARP00000072614 ENSDARP00000072614 ENSDARP00000072614 NP_001119954.1.45394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]