SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000072659 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000072659
Domain Number 1 Region: 44-100
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000000000301
Family HLH, helix-loop-helix DNA-binding domain 0.0031
Further Details:      
 
Domain Number 2 Region: 106-158
Classification Level Classification E-value
Superfamily Orange domain-like 0.0000000000000824
Family Hairy Orange domain 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000072659   Gene: ENSDARG00000055798   Transcript: ENSDART00000078197
Sequence length 310
Comment pep:known chromosome:Zv9:19:33929338:33936055:1 gene:ENSDARG00000055798 transcript:ENSDART00000078197 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKRPHDYSSPDSDTDELIDVGQEDSYCPVTGSMSPGSTSQILARKKRRGIIEKRRRDRIN
HSLSELRRLVPSAFEKQGSSKLEKAEILQMTVDHLKLLHAMGGKGYFDARALAVDYRTLG
FRECVGEVVRYLSSLEGVESSDPIGARLVSHLSHCASELDPLLQSPAALPFPPWPWASFP
QLQAASPPASSTPFPPNARRDLAPHGTATILGYPSPALRMGSLSTQGTILNPALTSVRQL
PSVPGHLHRLQQHSPEGRTVPSSSSSSSNSSPPQISFRPFVPAGSPAGGRRALSSSSKSA
QAWGTEIGAF
Download sequence
Identical sequences Q8AXV5
7955.ENSDARP00000072659 ENSDARP00000072659 ENSDARP00000072659

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]