SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000072931 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000072931
Domain Number 1 Region: 8-147
Classification Level Classification E-value
Superfamily TPR-like 0.0000000000000208
Family Tetratricopeptide repeat (TPR) 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000072931   Gene: ENSDARG00000056047   Transcript: ENSDART00000078469
Sequence length 269
Comment pep:known chromosome:Zv9:5:30781287:30790947:-1 gene:ENSDARG00000056047 transcript:ENSDART00000078469 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLYIELIRLWDEAVKAIDIRDWQGALSKLNQITDHNCRTMFVVASTHIALGQVDLAIKAL
DRVIAKDSCLAVGFFQRSAVHMMANRLEEALSDCIWAQKYMRENPVIDYKQLGLRYKLYS
WQVLYNAAAVHSRLQQWDKARDILLAASQERGAGRSNLIDTALEAISRKDVLEPLLLPEG
EVFRPRKLEVDQLKPRDFLGEAKVIQIFTLYCSFNACSSAEFEYWININVQNQLLQTIYD
KKGNAPSKGVSMFCPSALCTFVFSNYLKI
Download sequence
Identical sequences A5WWD9
7955.ENSDARP00000072931 ENSDARP00000072931 ENSDARP00000072931

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]