SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000073348 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000073348
Domain Number 1 Region: 59-116
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000000196
Family HLH, helix-loop-helix DNA-binding domain 0.0026
Further Details:      
 
Domain Number 2 Region: 131-173
Classification Level Classification E-value
Superfamily Orange domain-like 0.00000000379
Family Hairy Orange domain 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000073348   Gene: ENSDARG00000056400   Transcript: ENSDART00000078889
Sequence length 270
Comment pep:known chromosome:Zv9:1:16335287:16336940:1 gene:ENSDARG00000056400 transcript:ENSDART00000078889 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNARALYKRPPPVSSSQSEASGKRRTRTLDALGFDNYIICNYRLVFYEMMASKMKDRKKT
PVSHKVIEKRRRDRINRCLNELGKTVPMALAKQNSGKLEKAEILEMTVQYLRALHSADFP
RGREKGELLTEFANYFHYGYHECMKNLVHYLTTVERMETKDTKYARILAFLQSKVVTEPV
FGSLGTISPDPTDLLCQLEYQSPSPTESVFQQSPPGHFSWHSSTRSPTLAYPAMSQHSGY
LSPVQGLDHHYMNFIGHNAFSLHNAQHAAL
Download sequence
Identical sequences B2GQ63 Q6QB00
7955.ENSDARP00000073348 ENSDARP00000073348 ENSDARP00000073348 NP_996948.1.45394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]