SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000073394 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000073394
Domain Number 1 Region: 100-149
Classification Level Classification E-value
Superfamily Orange domain-like 4.18e-16
Family Hairy Orange domain 0.0024
Further Details:      
 
Domain Number 2 Region: 25-94
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000000000393
Family HLH, helix-loop-helix DNA-binding domain 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000073394   Gene: ENSDARG00000056438   Transcript: ENSDART00000078936
Sequence length 291
Comment pep:known chromosome:Zv9:23:23693662:23695447:-1 gene:ENSDARG00000056438 transcript:ENSDART00000078936 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPADNMEKQTASPIAGAPASGSHTPDKPKNASEHRKSSKPIMEKRRRARINESLGQLKTL
ILDALKKDSSRHSKLEKADILEMTVKHLRNLQRVQMSAALSADTNVLSKYRAGFNECMNE
VTRFLSTCEGVNTEVRSRLLNHLSGCMGQMMAMNYPQPAPAQQAHLAQPLHVQLPSTLPI
NGASMGSKLSPSEAVSPKVFGGFQLVPATDGQFAFLIPNPAFASATTPVIPLYANASVPV
TVNASPVQASSAPTVASPVQGMTSFSGVPQAVSPVGVSAGAESNEPVWRPW
Download sequence
Identical sequences Q9DF41
ENSDARP00000073394 NP_571948.1.45394 7955.ENSDARP00000073394 ENSDARP00000073394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]