SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000073475 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000073475
Domain Number 1 Region: 33-246
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.52e-67
Family SPRY domain 0.0000000122
Further Details:      
 
Weak hits

Sequence:  ENSDARP00000073475
Domain Number - Region: 235-272
Classification Level Classification E-value
Superfamily SOCS box-like 0.000128
Family SOCS box-like 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000073475   Gene: ENSDARG00000056515   Transcript: ENSDART00000079019
Sequence length 273
Comment pep:known chromosome:Zv9:23:22790456:22817445:-1 gene:ENSDARG00000056515 transcript:ENSDART00000079019 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGQKVPGGIKTVDMRDPAFRPLKLELQALDYTKPSRLDMLLDMPSASQDIQVQHSWNNDD
RSLNIFVKEDNKLIFHRHPVAQSTDAIRGRVGYTRGLHVWEISWAMRQRGTHAVVGVATG
EAPLHSVGYTALVGNNSESWGWDLGRNKLYHDGKNQPSRTYPAFLEPDETFIVPDSFLVV
LDMDEGTLSFIVDGQYLGVAFRGLKGKKLYPVVSAVWGHCEIRIRYINGLDPEPLPLMDL
CRRSVRVALGRERLSEIHGLPLPASLKNYLLYQ
Download sequence
Identical sequences Q4V8W1
ENSDARP00000073475 ENSDARP00000073475 NP_001020631.1.45394 XP_021325427.1.45394 7955.ENSDARP00000073475

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]