SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000073586 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000073586
Domain Number 1 Region: 325-567
Classification Level Classification E-value
Superfamily ClpP/crotonase 2.49e-54
Family Crotonase-like 0.0000000221
Further Details:      
 
Domain Number 2 Region: 3-64
Classification Level Classification E-value
Superfamily Chromo domain-like 2.58e-19
Family Chromo domain 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000073586   Gene: ENSDARG00000038985   Transcript: ENSDART00000079131
Sequence length 581
Comment pep:novel chromosome:Zv9:2:24186724:24241358:1 gene:ENSDARG00000038985 transcript:ENSDART00000079131 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMATEELYEVERIIGKRKNKKGKTEYLVRWRGYSFEGDTWEPEGHLSSCIEFIHEFNRQH
SEKQKDGTLLRSTRSSPSTANTSINARKQISRPQHPSANSNTAKTSTPTPNTHPTKRPQP
AQNSSNDSDSPQQKRGRSAGTSSIMGTVTETAPTAAPAAAPTVSALRRSMDLSKSGIKIL
VPKSPMNSRADTEESPSEAAHSLEQGSQEPDAVPPEVALLEKPAGAMRVPGEERARMGTR
PRTQTALPPPQIPITPAAVRTLNGKGVTTLMEASSANGTAITQSAAAGVMSSSGLTGKRR
FEERANFDKRLRFSVRQTESAYRYRDIVVKKQDGFTHILFSTKTSENNSLNPDVMKEVQS
AMATAAADDSKLVLLSGVGSVFCFGLDFIYFIRRLTDDRKKESIKMAETIRTFVNTFIQF
KKPIIAAVNGPAIGLGASILPLCDVIWANEKAWFQTPYTTFGQTPDACSSVTFPLIMGVA
SANEMLLSGRKLTAQEACAKGLVSQVLWPGTFTQEVMVRIKELVSCNSVVLRESKALVRN
INRAALEQANERECEALKRVWGSSQGMDSILKYLQKKIDEF
Download sequence
Identical sequences E7F6P0
ENSDARP00000073586 ENSDARP00000073586 XP_696879.5.45394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]