SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000073721 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000073721
Domain Number 1 Region: 18-74
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000000157
Family HLH, helix-loop-helix DNA-binding domain 0.0053
Further Details:      
 
Weak hits

Sequence:  ENSDARP00000073721
Domain Number - Region: 82-119
Classification Level Classification E-value
Superfamily Orange domain-like 0.0196
Family Hairy Orange domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000073721   Gene: ENSDARG00000009822   Transcript: ENSDART00000079265
Sequence length 152
Comment pep:novel chromosome:Zv9:23:21756163:21757930:-1 gene:ENSDARG00000009822 transcript:ENSDART00000079265 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTPTITGSISSRETLLTNKLRKPMVEKIRRERINSSIEKLKTLLAQEFVKQQPDSRQEKA
DILEMTLDFLRRSQKSSAAGDGRSRCVQEAVSFLSQCPVQTQSHTRLMKLFLHMQTPADQ
HTRVDNPQTTEKHANSSAKQHTPARSHIWRPW
Download sequence
Identical sequences B0V3D3
ENSDARP00000073721 NP_001121862.1.45394 7955.ENSDARP00000007386 ENSDARP00000073721

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]