SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000073752 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000073752
Domain Number 1 Region: 669-798
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.38e-31
Family Synaptotagmin-like (S variant) 0.00000112
Further Details:      
 
Domain Number 2 Region: 20-144
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.51e-28
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0022
Further Details:      
 
Domain Number 3 Region: 1319-1446
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 5.36e-23
Family Synaptotagmin-like (S variant) 0.0062
Further Details:      
 
Domain Number 4 Region: 499-622
Classification Level Classification E-value
Superfamily PDZ domain-like 1.71e-20
Family PDZ domain 0.00000348
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000073752   Gene: ENSDARG00000019622   Transcript: ENSDART00000079296
Sequence length 1473
Comment pep:known chromosome:Zv9:16:47173373:47484141:-1 gene:ENSDARG00000019622 transcript:ENSDART00000079296 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAPAGPRSGPVLPEMPDLSHLTEEERKIILGVMDRQKKEEEKEQSMLKKLHQQFEMYKD
QVQKMGEEAQSGPEQKSDAPTCGICHKTKFADGCGHLCSYCQTKFCARCGGRVSLRSNKV
MWVCNLCRKQQEILTKSGAWFFSGPGGALPAGASDPRRRHEEAPQEKKAKLQEAPLLYQS
SGDRSRAPGLPRQASLNNNSSLKPNDPTSNRKRSPSATRDPNQKYNQREEKADRSQYAPG
EGGMPRSPSDYGAGDRQWRGGCGRSYEDAEVARGAYRARRGGWHSQEEYPPEPGFLPDGP
PLSEHELQRQRQEEYQNRYRSDPNLARYPVKPQPYEEQMRMHAEVSRFRHERRHSDVSLA
YTEMEEPLGPLRGPHYSPGSGQTHWRSNHSPPGTDSAHRQQQLLDPVSAVRKSKREKMES
MLRNDSLSSDQSESVRPPPPKPHKTKRGGKMRQVSLSSSEEELATTPEYTSCEDVEIESE
SVSEKGDLDGHWWDHTTWHSSDASIMSLHPVTWQPSKDGDRLIGRILLNKRMKDGSVPRD
SGALLGLKVVGGKMTESGRLCAFITKVRKGSLADTVGHLRPGDQVLEWNGRQLQGATFKE
VYNIILESKPEPQVELVVSRPIGDIPRIPESTHAQLESSSSSFESQKMERPSISVTSPMS
PGVLRDAPQYLSGQLTVKLWYDKVGHQLIVTILGAKDLPSREDGRPRNPYVKIYFLPDRS
DKSKRRTKTVKKSLEPKWNQTFMYSPVHRREFRERMLEITLWDQARVREEESEFLGEILI
ELETALVDDEPHWYKLQTHDVSSVPLPKSSPSLQRRALHGDSPTRRLQRSQRISDSEFSD
YDCEDGVGVVSDYRNGRDLQSSTLSVPEQVLSSNHCSRSADINRARSRSPSMPPSQRNYG
GAPDRHEYHHRSRSADQRAAMERPMYSRSRSTERPPDGPHMRSSMPSLPSGHSAPSSPAL
SRAHPRGGSVQTSPTGTPINSRRGRQLPQLPPKGTLERKDGEEEVEACPGALDVEERTRQ
MKLKMNKYKQGTGSDSRLEQDYHKRSGRDPQRGENLSAKSSDSDVSDVSAVSRTSSASRF
SSMSYISVQSERPRGSRKISGRSLSREGEELQEGEGLREEVGGLEEERGSRRKTGKLSRQ
TESVELEESEEDKNQRTLSETDLRQMGTAAGGNMTKSTSIGGDMCSLEKTDGSQSDTAVS
LVGTDDKKRRSSIGAKMAAVVGLSRKSRSASQLGQTEAGGKKLRSTIQRSTETGLAVEMR
SRMTRQASRESTDGSMNSYSSEGNLIFPGVRLSSDSQFSDFLDGLGPAQLVGRQTLATPP
MGDIQIGMVEKKGALEVEVIRARGLVGKPGSKALPAPYVKVYLLENGACIAKKKTKVARK
TLDPLYQQQLSFEESPGGKVLQIIVWGDYGRMDHKSFMGAAQILLDDLDLSNMVIGWFKL
FPPSSLVDPTLAPLTRRASQTSLDSGSGPFARS
Download sequence
Identical sequences ENSDARP00000073752 ENSDARP00000073752

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]