SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000074271 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000074271
Domain Number 1 Region: 296-358
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 0.00000000418
Family Ypt/Rab-GAP domain of gyp1p 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000074271   Gene: ENSDARG00000057218   Transcript: ENSDART00000079820
Sequence length 367
Comment pep:known chromosome:Zv9:18:16661333:16679401:-1 gene:ENSDARG00000057218 transcript:ENSDART00000079820 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAATTPPKVVFEHEGVFIHSSPDESEDQDLISGFLRIVEKEGETLVEYKPLEDADPSNML
CACKDSSSVVEWTQSSEENPHRPVDHQLSYETEWDMINAVSFRRKVHANGDGGSNHVNEQ
NKRAFSFNVCDLRSVTVKCEGWSYLTFRLKDGTALPAIHFHQGGSKAFLDSLRKSVQINE
SPDDESVLIVSTYSKAFSQSFENLLDDTNYGFVQKFKKDPYTTTLGGFSKVTNYLFDAFR
APELECQQRPAEEVADVLGELIPGLEINQQEEPGFEVITRLDLGPRPEMQRTGPVTMEEW
AKYQDLEGRMTNLPHLKDAIFKGGLCHAVRKEAWKFLLGYFPWSSTHEERKLLQKRKTKR
CEPNRSQ
Download sequence
Identical sequences ENSDARP00000074271

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]