SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000074509 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000074509
Domain Number 1 Region: 40-114
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000000443
Family PHD domain 0.011
Further Details:      
 
Domain Number 2 Region: 138-216
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000000465
Family PHD domain 0.011
Further Details:      
 
Domain Number 3 Region: 1-50
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.00000000015
Family Tudor domain 0.0054
Further Details:      
 
Weak hits

Sequence:  ENSDARP00000074509
Domain Number - Region: 495-517
Classification Level Classification E-value
Superfamily Chromo domain-like 0.022
Family Chromo domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000074509   Gene: ENSDARG00000057439   Transcript: ENSDART00000080059
Sequence length 519
Comment pep:known_by_projection chromosome:Zv9:16:48489668:48507812:1 gene:ENSDARG00000057439 transcript:ENSDART00000080059 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EGEDVLARWSDGLLYLGNVKRVDSVKQCCLIRFEDNSEFWVLRKDIHSFSSGGEEVCCIC
DSPPLKEPLVNCLKCRHGYHPECHTPSIEPEVDPNSWICRQCVFAVATKRGGALKRGRFA
RLMQIMKVRLPYQLSSLDWDPQHLTNQQQCYCYCAGPGEWNLKMLQCGSCGQWFHEACTQ
CLSKPLLYGDRFYQFQCSVCSNGAESVQRLPMTWVDLAHLVLYHLSLCCKRKYFDFDHEI
MSFANENWESLLLGTLSDTPRQDRCQNLLNALNSHKDRFVSGKEIKKKKCLFGLQVRAPP
PLSSDQSPFIAEQPINITHRRSPSSVSCQRRAVAPDVRKPKRRVTETQVSAETEIKHHCQ
EFVQAHRQSCPAGVAADALDRVPCCRGYEGSNLYNSRKPDEEMSLGSPPKRMFALYHPSY
NASQDLSRALHHYSAEDPCGLPAPCLPCSVSSAHAPAQRYESCPSLFLRDVPPFHSPVGM
AAPSSMGWAGGDAVRILARRVTADGKLQYLVEWGNVSVY
Download sequence
Identical sequences ENSDARP00000074509 ENSDARP00000074509

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]