SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000074553 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000074553
Domain Number 1 Region: 55-138
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000000262
Family HLH, helix-loop-helix DNA-binding domain 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000074553   Gene: ENSDARG00000057432   Transcript: ENSDART00000080103
Sequence length 200
Comment pep:known chromosome:Zv9:14:19999132:20012348:-1 gene:ENSDARG00000057432 transcript:ENSDART00000080103 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEVNTCNIQVLLQAAEYLERREREAEHGYASVLPFYSNGVSDKRKKQKSKSHSSPGNSRS
VHNELEKHRRAQLRHCLEQLKQQVPLSSDSSRNTTLNLLRQAQLHIKKLQEQDERAKLLK
DRLRWEQRELRTRLEKLQGGSERMRNDSLGSAVSSERSDSEREDVEIDVESMVWTLEADA
LGSSHAGVDHSYSTSDHAWL
Download sequence
Identical sequences A0A0R4IMG7
7955.ENSDARP00000074553 ENSDARP00000074553 ENSDARP00000074553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]