SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000074556 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000074556
Domain Number 1 Region: 99-328,376-424
Classification Level Classification E-value
Superfamily MFS general substrate transporter 7.46e-48
Family LacY-like proton/sugar symporter 0.031
Further Details:      
 
Domain Number 2 Region: 547-684
Classification Level Classification E-value
Superfamily MFS general substrate transporter 1.44e-19
Family Glycerol-3-phosphate transporter 0.045
Further Details:      
 
Domain Number 3 Region: 447-527
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 0.0000000000981
Family Pentapeptide repeats 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000074556   Gene: ENSDARG00000057427   Transcript: ENSDART00000080106
Sequence length 689
Comment pep:known chromosome:Zv9:7:16034939:16072687:1 gene:ENSDARG00000057427 transcript:ENSDART00000080106 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDDPYQNNINQQGEAYPTYGEGGEYTYPYQTDYPRQEEDDAASDATEGHDEDDQMYEGEY
QGVPHPDEIKEARRAARREARMKARMAAEVEEETLPDQYESIMEDCGHGRFQWTLFTVLG
LALMADGVECFVVSFALPSAEKDMCLSNADKGMLGLIVYVGMMIGAVVWGGLADKLGRKQ
CLLYALAINCIFSFLSCFAQGYGFFIFFRLCSGIGIGGSIPVVYTYYAEFLQMDKRGEHL
SWLCLFWMLGGLYASFTAWGIIPHYGWGFSMGTEFQFHSWRVFVLVCFLPSVAALAGLVF
MPESPRFLLESARHDEAWMILRRVHDTNWRAKGEPERVFQVSQIKTPQTQDDEFIEIQSE
TGTAFQRFMVRQMTLVKQVMKNMLSLAAPDVRLHGLFIAIVWFTMAFSYYGLGTWFPDQI
KYLQFEEYESNVKIFHRERVERFHFNFTLQNQLHKEGEYVHDRFINIEIRNVKFEDSLFE
NCYFEDIKSTETFFENCTLKNTVFYNTDLWEDSKFINCNLENTTFLHPKKGCHLNFQEEN
DILIYLDSFLGSLSVIPGNILAGLLMDKIGRLKIIGGSMLGSAVCTFFLLLCFSQWAVVL
FQCLFFAAGAAAWNGIEVVTVELYPASKRATAFGVLNGTCKLAAIISSFIFGKFIGITKI
IPIILSFSALVCGGLLAFKLPETREVILQ
Download sequence
Identical sequences F1Q9Q1
ENSDARP00000074556 7955.ENSDARP00000074556 ENSDARP00000074556 ENSDARP00000106886

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]