SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000074854 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000074854
Domain Number 1 Region: 654-805
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.15e-34
Family Ankyrin repeat 0.00049
Further Details:      
 
Domain Number 2 Region: 13-76
Classification Level Classification E-value
Superfamily Chromo domain-like 1.22e-18
Family Chromo domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000074854   Gene: ENSDARG00000005576   Transcript: ENSDART00000080404
Sequence length 946
Comment pep:novel chromosome:Zv9:9:22495812:22522321:-1 gene:ENSDARG00000005576 transcript:ENSDART00000080404 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASGAERAEPGDSEQDEEDVYEVERIIDVRVEEGEVLYRVRWKNYSSEDDTWEPEAHLDD
CKEVLLAYKKALAELKPKKEPAMLPMKSDLFDADSESDSDKEKPKESPMKKKKKKKKKKI
EDSDDEMSVREKKKKKKKEKWREDKPLPAPESDEEESRDPSPAPSKKETKKRFIDSDDED
VPVTPKKQKKLDKPKDAGKVKKESGEERKKKKIKSKREIDSSDEDEKSDAPSESHTDDTT
NTETNDSFKTTTKITEKPVRSESGGDLKQVKQKKDKSDIKLQGFKDLILEKKPKKPEASS
AAAKDVGLNKIKSLTGSKSTSKSSRSEEEPDSSDTGAAASAPKAKVKSKSQEAAPSSQRL
SSASSSSSSSTASTAPIKPREDEAKEEAGDKASASNLFEKFLLNCEAKDRAPRRQVDQNK
SATPKGGSKNDKKTKPSKQSPGRKPDSDKTKDVPRSSQSPISMEVDEKQEKGSSELEKSE
KSDEPNFKSKEELQREQREEEQRKRKEKMEEEERKRKERIEEEERKKKERIEEAQRERKA
RLEEAQRFAEEARQELERKSMAESIVSPDSTEDSRWKDKRRKRRDDSESRVFTTCDDNQD
SQETVERSDKTPDRGPPSLNLGVELKLDWMTLEDFQKHLNGEDENLSPLALTPTELREAV
KNGNYLAVKRALSSKEDYNLDQEDSSGMSLTLLAAAGGQDDILRLLIKKGVKVNSRQKTG
TTALMHAADKNFLTTVAILLEAGAFVNAQTLGGETALMKACKRGNADVVRLLLEYGADCN
ILSKHKNTALYYAKLSNNLMVYDLIKDHMQTLSTVAEETIRAYFETRLALLEPVFPLACH
RLCEGPDFSLEFNYKPPQHAPGEGSGILLFIFHANFLNEITARLCGPCSVHAVVLNDKFQ
LPIFLDSHFIYSFSPVQGANKMFIRLAESPTAKVKLLICAYRVQLQ
Download sequence
Identical sequences B0S768
NP_001119905.1.45394 7955.ENSDARP00000074854 ENSDARP00000074854 ENSDARP00000074854

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]