SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000075286 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000075286
Domain Number 1 Region: 106-182
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 3.01e-16
Family HLH, helix-loop-helix DNA-binding domain 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000075286   Gene: ENSDARG00000058039   Transcript: ENSDART00000080840
Sequence length 238
Comment pep:known chromosome:Zv9:24:25069506:25071293:1 gene:ENSDARG00000058039 transcript:ENSDART00000080840 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSFRPTAGIDLSARDSQSPISCFEQNDPDPVQPGGRAGTLGLPTGSLCVKYGESANRTS
GAESSGGEQSPDDDSDERCEMMLMTDGRTTVPGAKSEGGKKNKEQKMLRLNINARERRRM
HDLNDALDELRAVIPYAHSPSVRKLSKIATLLLAKNYILMQAQALEEMRRLVAYLNQGQA
ISAASLPATTALTPGLSAYEQPAGYPFPAGVAASSCPDKCALFNNVTSSLCKQCTDKP
Download sequence
Identical sequences Q7T301
ENSDARP00000075286 7955.ENSDARP00000075286

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]