SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000076703 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000076703
Domain Number 1 Region: 42-138
Classification Level Classification E-value
Superfamily PDZ domain-like 5.39e-24
Family HtrA-like serine proteases 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000076703   Gene: ENSDARG00000090177   Transcript: ENSDART00000082266
Sequence length 141
Comment pep:known_by_projection chromosome:Zv9:10:35213579:35214825:1 gene:ENSDARG00000090177 transcript:ENSDART00000082266 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DGEVIGINTMKVTAGISFAVRLFLDRSVDRVKSWFGESGSKRRYTGVMMLTLTPSIIDEL
RMRDPSFPDVSHGVLIHRVIVGSPANRAGMKPGDVIIEINGVKVNTSEEIYNAVRTSESL
NVVVRRGADLLMLHMTPESTE
Download sequence
Identical sequences ENSDARP00000076703

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]