SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000077794 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000077794
Domain Number 1 Region: 75-276
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 1.57e-56
Family CRAL/TRIO domain 0.0000000478
Further Details:      
 
Domain Number 2 Region: 278-393
Classification Level Classification E-value
Superfamily Supernatant protein factor (SPF), C-terminal domain 1.19e-37
Family Supernatant protein factor (SPF), C-terminal domain 0.00000325
Further Details:      
 
Domain Number 3 Region: 2-74
Classification Level Classification E-value
Superfamily CRAL/TRIO N-terminal domain 5.36e-21
Family CRAL/TRIO N-terminal domain 0.0000606
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000077794   Gene: ENSDARG00000059729   Transcript: ENSDART00000083359
Sequence length 395
Comment pep:novel chromosome:Zv9:5:14630172:14671653:1 gene:ENSDARG00000059729 transcript:ENSDART00000083359 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGRVGDLSVKQAEALAQFREKVQDVLPQCPSQSDHFLLRWLRARNFNLQKSEAMLRKHI
EFRKHMKVDTITTEWQVPEVIDKYLSGGMCGHDREGSPVWYDVIGPLDPKGLMHSASKQD
LIKSKVRDCEILQKDCDRQSERLGRNIESITMVYDCEGLGMKHLYKPAIETYGEVLTMFE
DNYPEGLKRLFVIKAPKLFPVAYNLVKHFLSEDTRRKVIVLGSNWQEVLQKYIDPEELPA
YYGGKLTDPDGDPKCRTRITFGSEIPKSYYVRDSIKVDYEQSVSIGRGSSHQMEYELIAP
NCALRWQFSCDGADIGFGVYLKKKMGERMKAGEMREIVPNQRYNAHLVPEDGSLTCPEPG
VYVLRFDNTYSVFQSKTVKFTVEVLLPSQVNQSDN
Download sequence
Identical sequences A2BIR0
NP_001093463.1.45394 ENSDARP00000077794 ENSDARP00000077794

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]