SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000078040 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000078040
Domain Number 1 Region: 177-366
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 1.91e-44
Family Ypt/Rab-GAP domain of gyp1p 0.004
Further Details:      
 
Domain Number 2 Region: 343-415,712-793
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 6.8e-30
Family Ypt/Rab-GAP domain of gyp1p 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000078040   Gene: ENSDARG00000075333   Transcript: ENSDART00000083605
Sequence length 863
Comment pep:novel chromosome:Zv9:8:24511569:24523437:1 gene:ENSDARG00000075333 transcript:ENSDART00000083605 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVEEERGVVRVKVKKCEGVLPVEFRSFAVDPQITSLEVLQHILIRAFELNGKRNFGISY
LSRDRAGVEVYVSLLSDWDLDAAFVSAAKPYLQLKMDIKPSEDSPVLEDWDIISPKDVIG
SDQLQGEKRSLASAALPFTQSLLSQVGRTLSRVQQALSWSYGEEVKPFKPPLSDAEFHNY
LNSQGQLSRPEELRLRIYHGGVESSLRKVVWRYLLNVYPDGLTGQERMDYMKRKTREYDQ
LKSEWTARVSSEELEFIRGNVLKDVLRTDRAHPYYAGSEDSPHLTALTDLLTTFAITHPQ
VSYCQGMSDIASPILAVMDNEAHAFICFCGIMKRLEGNFRPDGQLMSIKFQHLKLLLQYS
DPEFYSYLVSKGADDLFFCYRWLLLELKREFAFDDALRMLEVTWSSLPPDPPETEVELLG
PAFEADQSDGSHNVDMEEMEEKQTERQRRRHMLRPSREEADGERNLVMEEERGPRKEGEG
EYDVESMVRNDIPAQPPSFEKQGSFGEFKYYNGRTEDSFEVNENDSSDPTLSPVQFQSAH
STLPFSVRQSTEESEDDPGEQEPLINNLTPSSPGQRDSPNGQAASPLSTLPSGLPNWKSS
SNQSSNSASSWRTASPDALSKCTSSSSSGEKALSPDKPSGGFASSQPVLNGTGAQSPSVV
PGKSLLASPSQGYNHSLLSSPVLSFGKSPSLPKAFSSNLPSPCRPTGSGVSSPNTNKPEG
GGIKPCSLPPPQEFGKGNPFMLFLCLSILLEHRDHIIKNSLDYNELAMHFDRLVRRHNLG
RILQRAKALFADYLQSEVWDSEEGDEVSLDSPTTAATSPQTPSTRPPFLNVQPSQGAFPN
STYNLANTIPSPTTPIALSPSAS
Download sequence
Identical sequences B0S696
ENSDARP00000078040 7955.ENSDARP00000078040 NP_001121708.1.45394 ENSDARP00000078040

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]