SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000078354 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000078354
Domain Number 1 Region: 146-373,417-466
Classification Level Classification E-value
Superfamily MFS general substrate transporter 1.7e-50
Family Glycerol-3-phosphate transporter 0.055
Further Details:      
 
Domain Number 2 Region: 585-731
Classification Level Classification E-value
Superfamily MFS general substrate transporter 8.37e-17
Family Glycerol-3-phosphate transporter 0.058
Further Details:      
 
Domain Number 3 Region: 490-571
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 0.00000000209
Family Pentapeptide repeats 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000078354   Gene: ENSDARG00000059945   Transcript: ENSDART00000083919
Sequence length 734
Comment pep:known_by_projection chromosome:Zv9:16:49213053:49260428:1 gene:ENSDARG00000059945 transcript:ENSDART00000083919 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDEGYRDRSAFIKGAKDIAKEVKRHAGKKVGRHVDKMTDEYTKRSYTRFEEDDDDDDYPV
QAQDGSYYRSNSRANDDEGAHSDSTEGHDEDDEIYEGEYQGIPRNDSVEKADRQVGAVGQ
SQFRDMTQYEGERRKDQEELAQQYETILQECGHGRFQWTLYFVLGLALMADGVEIFVVGF
VLPSAEKDMCLSEPNKGMLGLIVYLGMMVGAFVWGGLADRIGRRQTLLISLSINSVFAFF
SSFVQGYSSFLFCRLLSGVGIGGSIPIVFSYYSEFLAQEKRGEHLSWLCMFWMIGGIYAA
AMAWAIIPHYGWSFQMGSAYQFHSWRVFVLVCAFPSVAAIAALTTMPESPRFYLENGKHD
EAWMILKQVHDTNMRAKGYPERVFSVTTIKTVKQMDELVDMGGEATAWHQRWRIKLTNLF
HQVWGNFLTVFNPEYRRITYMMMAVWFSMSFSYYGLTVWFPDMIKYLQKQEYSSRTKVFI
KEKVEHVTFNFTLENQIHRNGEYFNNKFLNLKMKSMVFEDSLFEECYFEDITSSNTFFRN
CTFISTLFYNTDLFKYRLINSKLINSTFLHNKEGCMLDFSDENNAYMIYFVSFLGTLAVL
PGNIVSALLMDKIGRLRMLAGSSVISCVSCFFLSFGNSESAMIALLCLFGGISIASWNAL
DVLTVELYPSDKSRTTAFGFLNALCKLAAVLGISIFQSFVGITKAVPILFASGALAAGSF
LALKLPETRGQVLQ
Download sequence
Identical sequences ENSDARP00000078354 ENSDARP00000078354

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]